PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G33090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 254aa    MW: 27621.2 Da    PI: 5.0146
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G33090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++lv      G  +W+++++  g+ R++k+c++rw +yl
  ORUFI02G33090.1 14 KGPWTADEDQKLVTFLLSNGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.82.5e-1870111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++eE++l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  ORUFI02G33090.1  70 LSEEEEKLVIDLHEQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-19563IPR009057Homeodomain-like
PROSITE profilePS5129413.881961IPR017930Myb domain
SuperFamilySSF466897.49E-2711108IPR009057Homeodomain-like
SMARTSM007175.7E-111363IPR001005SANT/Myb domain
PfamPF002495.4E-131461IPR001005SANT/Myb domain
CDDcd001672.88E-81661No hitNo description
PROSITE profilePS5129427.85562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2564117IPR009057Homeodomain-like
SMARTSM007172.4E-1666114IPR001005SANT/Myb domain
PfamPF002493.0E-1670111IPR001005SANT/Myb domain
CDDcd001671.82E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTAD EDQKLVTFLL SNGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEEEEKLVID LHEQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLKKMG  120
LDPVTHRPVM SLAQPDPLKQ QQQQQEPSVS GGTGADDKEE EEETPTSAQP QGVACAASSA  180
SAVSSSCSSS ASASAATPGA DVDWPGLFEV DAILDIDWAG LLSACGDDGG CSAIGVDMLF  240
DQCSDVGFDQ DVWM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087090.0AK108709.1 Oryza sativa Japonica Group cDNA clone:002-150-A10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624871.11e-162PREDICTED: protein ODORANT1
SwissprotQ50EX62e-82ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D9YXV11e-175A0A0D9YXV1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NKK40.0A0A0E0NKK4_ORYRU; Uncharacterized protein
TrEMBLA2X9A40.0A2X9A4_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA005676-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.12e-82myb domain protein 20